Lineage for d1dbvr1 (1dbv R:0-148,R:313-333)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 238223Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 238224Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families) (S)
  5. 238741Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (12 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 238834Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (13 species)
  7. 238843Species Bacillus stearothermophilus, nca 1503 [TaxId:1422] [51803] (6 PDB entries)
  8. 238851Domain d1dbvr1: 1dbv R:0-148,R:313-333 [29969]
    Other proteins in same PDB: d1dbvo2, d1dbvp2, d1dbvq2, d1dbvr2
    complexed with nad, so4; mutant

Details for d1dbvr1

PDB Entry: 1dbv (more details), 2.5 Å

PDB Description: glyceraldehyde-3-phosphate dehydrogenase mutant with asp 32 replaced by gly, leu 187 replaced by ala, and pro 188 replaced by ser complexed with nad+

SCOP Domain Sequences for d1dbvr1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dbvr1 c.2.1.3 (R:0-148,R:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503}
avkvgingfgrigrnvfraalknpdievvavngltdantlahllkydsvhgrldaevsvn
gnnlvvngkeiivkaerdpenlawgeigvdivvestgrftkredaakhleagakkviisa
pakneditivmgvnqdkydpkahhvisnasXnetgyshrvvdlaayiaskgl

SCOP Domain Coordinates for d1dbvr1:

Click to download the PDB-style file with coordinates for d1dbvr1.
(The format of our PDB-style files is described here.)

Timeline for d1dbvr1: