Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins) family members also share a common alpha+beta fold in C-terminal domain |
Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (19 species) |
Species Bacillus stearothermophilus, nca 1503 [TaxId:1422] [51803] (11 PDB entries) |
Domain d1dbvq1: 1dbv Q:0-148,Q:313-333 [29968] Other proteins in same PDB: d1dbvo2, d1dbvp2, d1dbvq2, d1dbvr2 complexed with nad, so4; mutant |
PDB Entry: 1dbv (more details), 2.5 Å
SCOPe Domain Sequences for d1dbvq1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dbvq1 c.2.1.3 (Q:0-148,Q:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503 [TaxId: 1422]} avkvgingfgrigrnvfraalknpdievvavngltdantlahllkydsvhgrldaevsvn gnnlvvngkeiivkaerdpenlawgeigvdivvestgrftkredaakhleagakkviisa pakneditivmgvnqdkydpkahhvisnasXnetgyshrvvdlaayiaskgl
Timeline for d1dbvq1: