SCOP 1.75: Domain d1dbvo1: 1dbv O:0-148,O:313-333

Lineage for d1dbvo1 (1dbv O:0-148,O:313-333)

Root: SCOP 1.75
Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
The nucleotide-binding modes of this and the next two folds/superfamilies are similar

Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families)
Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
family members also share a common alpha+beta fold in C-terminal domain
Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (19 species)
Species Bacillus stearothermophilus, nca 1503 [TaxId:1422] [51803] (11 PDB entries)
Domain d1dbvo1: 1dbv O:0-148,O:313-333 [29966]
Other proteins in same PDB: d1dbvo2, d1dbvp2, d1dbvq2, d1dbvr2

Details for d1dbvo1

PDB Entry: 1dbv (more details), 2.5 Å

PDB Description: glyceraldehyde-3-phosphate dehydrogenase mutant with asp 32 replaced by gly, leu 187 replaced by ala, and pro 188 replaced by ser complexed with nad+

PDB Compounds: (O:) glyceraldehyde-3-phosphate dehydrogenase

SCOP Domain Sequences for d1dbvo1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dbvo1 c.2.1.3 (O:0-148,O:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503 [TaxId: 1422]}
avkvgingfgrigrnvfraalknpdievvavngltdantlahllkydsvhgrldaevsvn
gnnlvvngkeiivkaerdpenlawgeigvdivvestgrftkredaakhleagakkviisa
pakneditivmgvnqdkydpkahhvisnasXnetgyshrvvdlaayiaskgl

SCOP Domain Coordinates for d1dbvo1:

Click to download the PDB-style file with coordinates for d1dbvo1.
(The format of our PDB-style files is described here.)

Timeline for d1dbvo1: