SCOP 1.59: Domain d1gd1q1: 1gd1 Q:0-148,Q:313-333

Lineage for d1gd1q1 (1gd1 Q:0-148,Q:313-333)

Root: SCOP 1.59
Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families)
Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (10 proteins)
Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (12 species)
Species Bacillus stearothermophilus, nca 1503 [TaxId:1422] [51803] (6 PDB entries)
Domain d1gd1q1: 1gd1 Q:0-148,Q:313-333 [29964]
Other proteins in same PDB: d1gd1o2, d1gd1p2, d1gd1q2, d1gd1r2

Details for d1gd1q1

PDB Entry: 1gd1 (more details), 1.8 Å

PDB Description: structure of holo-glyceraldehyde-3-phosphate dehydrogenase from bacillus stearothermophilus at 1.8 angstroms resolution

SCOP Domain Sequences for d1gd1q1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gd1q1 c.2.1.3 (Q:0-148,Q:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503}
avkvgingfgrigrnvfraalknpdievvavndltdantlahllkydsvhgrldaevsvn
gnnlvvngkeiivkaerdpenlawgeigvdivvestgrftkredaakhleagakkviisa
pakneditivmgvnqdkydpkahhvisnasXnetgyshrvvdlaayiaskgl

SCOP Domain Coordinates for d1gd1q1:

Click to download the PDB-style file with coordinates for d1gd1q1.
(The format of our PDB-style files is described here.)

Timeline for d1gd1q1: