SCOP 1.63: Domain d1gd1o1: 1gd1 O:0-148,O:313-333

Lineage for d1gd1o1 (1gd1 O:0-148,O:313-333)

Root: SCOP 1.63
Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
The nucleotide-binding modes of this and the next two folds/superfamilies are similar

Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families)
Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (12 proteins)
family members also share a common alpha+beta fold in C-terminal domain
Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (13 species)
Species Bacillus stearothermophilus, nca 1503 [TaxId:1422] [51803] (6 PDB entries)
Domain d1gd1o1: 1gd1 O:0-148,O:313-333 [29962]
Other proteins in same PDB: d1gd1o2, d1gd1p2, d1gd1q2, d1gd1r2

Details for d1gd1o1

PDB Entry: 1gd1 (more details), 1.8 Å

PDB Description: structure of holo-glyceraldehyde-3-phosphate dehydrogenase from bacillus stearothermophilus at 1.8 angstroms resolution

SCOP Domain Sequences for d1gd1o1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gd1o1 c.2.1.3 (O:0-148,O:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503}
avkvgingfgrigrnvfraalknpdievvavndltdantlahllkydsvhgrldaevsvn
gnnlvvngkeiivkaerdpenlawgeigvdivvestgrftkredaakhleagakkviisa
pakneditivmgvnqdkydpkahhvisnasXnetgyshrvvdlaayiaskgl

SCOP Domain Coordinates for d1gd1o1:

Click to download the PDB-style file with coordinates for d1gd1o1.
(The format of our PDB-style files is described here.)

Timeline for d1gd1o1: