Lineage for d1dc5a1 (1dc5 A:0-148,A:313-330)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 476939Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 476940Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 477749Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (17 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 477908Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (16 species)
  7. 477961Species Escherichia coli [TaxId:562] [51802] (7 PDB entries)
  8. 477963Domain d1dc5a1: 1dc5 A:0-148,A:313-330 [29952]
    Other proteins in same PDB: d1dc5a2, d1dc5b2

Details for d1dc5a1

PDB Entry: 1dc5 (more details), 2 Å

PDB Description: structural analysis of glyceraldehyde 3-phosphate dehydrogenase from escherichia coli: direct evidence for substrate binding and cofactor-induced conformational changes

SCOP Domain Sequences for d1dc5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dc5a1 c.2.1.3 (A:0-148,A:313-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Escherichia coli}
tikvgingfgrigrivfraaqkrsdieivaindlldadymaymlkydsthgrfdgtvevk
dghlivngkkirvtaerdpanlkwdevgvdvvaeatglfltdetarkhitagakkvvmtg
pskdntpmfvkganfdkyagqdivsnasXnetgysnkvldliahisk

SCOP Domain Coordinates for d1dc5a1:

Click to download the PDB-style file with coordinates for d1dc5a1.
(The format of our PDB-style files is described here.)

Timeline for d1dc5a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dc5a2