![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins) family members also share a common alpha+beta fold in C-terminal domain |
![]() | Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (19 species) |
![]() | Species Escherichia coli [TaxId:562] [51802] (9 PDB entries) Uniprot P06977 |
![]() | Domain d1gado1: 1gad O:0-148,O:313-330 [29950] Other proteins in same PDB: d1gado2, d1gadp2 complexed with nad; mutant |
PDB Entry: 1gad (more details), 1.8 Å
SCOPe Domain Sequences for d1gado1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gado1 c.2.1.3 (O:0-148,O:313-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Escherichia coli [TaxId: 562]} tikvgingfgrigrivfraaqkrsdieivaindlldadymaymlkydsthgrfdgtvevk dghlivngkkirvtaerdpanlkwdevgvdvvaeatglfltdetarkhitagakkvvmtg pskdntpmfvkganfdkyagqdivsnasXnetgysnkvldliahisk
Timeline for d1gado1: