![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
![]() | Superfamily d.3.1: Cysteine proteinases [54001] (24 families) ![]() the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
![]() | Family d.3.1.23: Papain-like viral protease catalytic domain [310648] (2 proteins) C-terminal part of Pfam PF08715 |
![]() | Protein automated matches [310868] (6 species) not a true protein |
![]() | Species SARS coronavirus [TaxId:227859] [311282] (4 PDB entries) |
![]() | Domain d4m0wa2: 4m0w A:63-319 [299381] Other proteins in same PDB: d4m0wa1, d4m0wb_ automated match to d2fe8a2 complexed with gol, na, nhe, zn; mutant |
PDB Entry: 4m0w (more details), 1.4 Å
SCOPe Domain Sequences for d4m0wa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4m0wa2 d.3.1.23 (A:63-319) automated matches {SARS coronavirus [TaxId: 227859]} dtlrseafeyyhtldesflgrymsalnhtkkwkfpqvggltsikwadnnsylssvllalq qlevkfnapalqeayyraragdaanfcalilaysnktvgelgdvretmthllqhanlesa krvlnvvckhcgqktttltgveavmymgtlsydnlktgvsipcvcgrdatqylvqqessf vmmsappaeyklqqgtflcaneytgnyqcghythitaketlyridgahltkmseykgpvt dvfyketsytttikpvs
Timeline for d4m0wa2: