![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) ![]() |
![]() | Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (16 proteins) N-terminal all-beta domain defines family |
![]() | Protein Alcohol dehydrogenase [51737] (9 species) |
![]() | Species Human (Homo sapiens), different isozymes [TaxId:9606] [51739] (24 PDB entries) Uniprot P00326 Uniprot P00325 Uniprot P07327 Uniprot P00326 ! Uniprot P00325 ! Uniprot P07327 |
![]() | Domain d1d1tb2: 1d1t B:163-338 [29736] Other proteins in same PDB: d1d1ta1, d1d1tb1, d1d1tc1, d1d1td1 sigma isozyme |
PDB Entry: 1d1t (more details), 2.4 Å
SCOP Domain Sequences for d1d1tb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d1tb2 c.2.1.1 (B:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} aappekvcligcgfstgygaavktgkvkpgstcvvfglggvglsvimgcksagasriigi dlnkdkfekamavgatecispkdstkpisevlsemtgnnvgytfevighletmidalasc hmnygtsvvvgvppsakmltydpmllftgrtwkgcvfgglksrddvpklvteflak
Timeline for d1d1tb2: