Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.0: automated matches [191359] (1 protein) not a true family |
Protein automated matches [190417] (25 species) not a true protein |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [188319] (25 PDB entries) |
Domain d4cztd1: 4czt D:25-324 [296928] Other proteins in same PDB: d4czta2, d4cztb2, d4cztd2 automated match to d4czua_ complexed with cps, so4 |
PDB Entry: 4czt (more details), 2.3 Å
SCOPe Domain Sequences for d4cztd1:
Sequence, based on SEQRES records: (download)
>d4cztd1 d.144.1.0 (D:25-324) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} rtrvgkyelgrtlgegtfakvkfarnvengdnvaikvidkekvlknkmiaqikreistmk likhpnvirmfevmasktkiyfvlefvtggelfdkissngrlkedearkyfqqlinavdy chsrgvyhrdlkpenllldangalkvsdfglsalpqqvredgllhttcgtpnyvapevin nkgydgakadlwscgvilfvlmagylpfedsnltslykkifkaeftcppwfsasakklik rildpnpatritfaevienewfkkgykapkfenadvslddvdaifddsgesknlvverre
>d4cztd1 d.144.1.0 (D:25-324) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} rtrvgkyelgrtlgegtfakvkfarnvengdnvaikvidkekvlknkmiaqikreistmk likhpnvirmfevmasktkiyfvlefvtggelfdkissngrlkedearkyfqqlinavdy chsrgvyhrdlkpenllldangalkvsdfglsalpqqvredgllhttcgtpnyvapevin nkgydgakadlwscgvilfvlmagylpfedsnltslykkifkaeftcppwfsasakklik rildpnpatritfaevienewfkkgykapkfenadvslddvdaifddsnlvverre
Timeline for d4cztd1: