Lineage for d1bslb_ (1bsl B:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies) 
Superfamily c.1.16: Bacterial luciferase-like [51679] (3 families) 
Family c.1.16.1: Bacterial luciferase (alkanal monooxygenase) [51680] (1 protein) Protein Bacterial luciferase (alkanal monooxygenase) [51681] (1 species) Species Vibrio harveyi [TaxId:669] [51682] (4 PDB entries) 
Domain d1bslb_: 1bsl B: [29550]
Details for d1bslb_
PDB Entry: 1bsl (more details), 1.95 Å
PDB Description: structure of alkanal monooxygenase beta chain
SCOP Domain Sequences for d1bslb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bslb_ c.1.16.1 (B:) Bacterial luciferase (alkanal monooxygenase) {Vibrio harveyi}
mkfglfflnfmnskrssdqvieemldtahyvdqlkfdtlavyenhfsnngvvgapltvag
fllgmtknakvaslnhvitthhpvrvaeeaclldqmsegrfafgfsdceksadmrffnrp
tdsqfqlfsechkiindafttgychpnndfysfpkisvnphafteggpaqfvnatskevv
ewaaklglplvfrwddsnaqrkeyaglyhevaqahgvdvsqvrhkltllvnqnvdgeaar
aearvyleefvresysntdfeqkmgellsenaigtyeestqaarvaieccgaadllmsfe
smedkaqqravidvvnanivkyhs
SCOP Domain Coordinates for d1bslb_:
Click to download the PDB-style file with coordinates for d1bslb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bslb_:
- d1bslb_ appears in SCOP 1.57
- d1bslb_ appears in the current release, SCOPe 2.08
View in 3D
