Lineage for d1bsla_ (1bsl A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2839499Superfamily c.1.16: Bacterial luciferase-like [51679] (5 families) (S)
    consists of clearly related families of somewhat different folds
  5. 2839500Family c.1.16.1: Bacterial luciferase (alkanal monooxygenase) [51680] (3 proteins)
    typical (beta/alpha)8-barrel fold
    heterodimer of two similar chains
  6. 2839506Protein Bacterial luciferase beta chain, LuxB [88707] (1 species)
  7. 2839507Species Vibrio harveyi [TaxId:669] [88708] (4 PDB entries)
  8. 2839509Domain d1bsla_: 1bsl A: [29549]
    beta2 homodimer

Details for d1bsla_

PDB Entry: 1bsl (more details), 1.95 Å

PDB Description: structure of alkanal monooxygenase beta chain
PDB Compounds: (A:) bacterial luciferase

SCOPe Domain Sequences for d1bsla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bsla_ c.1.16.1 (A:) Bacterial luciferase beta chain, LuxB {Vibrio harveyi [TaxId: 669]}
mkfglfflnfmnskrssdqvieemldtahyvdqlkfdtlavyenhfsnngvvgapltvag
fllgmtknakvaslnhvitthhpvrvaeeaclldqmsegrfafgfsdceksadmrffnrp
tdsqfqlfsechkiindafttgychpnndfysfpkisvnphafteggpaqfvnatskevv
ewaaklglplvfrwddsnaqrkeyaglyhevaqahgvdvsqvrhkltllvnqnvdgeaar
aearvyleefvresysntdfeqkmgellsenaigtyeestqaarvaieccgaadllmsfe
smedkaqqravidvvnanivkyh

SCOPe Domain Coordinates for d1bsla_:

Click to download the PDB-style file with coordinates for d1bsla_.
(The format of our PDB-style files is described here.)

Timeline for d1bsla_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1bslb_