Lineage for d1a0cd_ (1a0c D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2839044Superfamily c.1.15: Xylose isomerase-like [51658] (8 families) (S)
    different families share similar but non-identical metal-binding sites
  5. 2839095Family c.1.15.3: Xylose isomerase [51665] (2 proteins)
  6. 2839096Protein D-xylose isomerase [51666] (13 species)
  7. 2839194Species Clostridium thermosulfurogenes, also known as Thermoanaerobacter thermosulfurigenes [TaxId:33950] [51674] (1 PDB entry)
  8. 2839198Domain d1a0cd_: 1a0c D: [29532]
    complexed with co

Details for d1a0cd_

PDB Entry: 1a0c (more details), 2.5 Å

PDB Description: xylose isomerase from thermoanaerobacterium thermosulfurigenes
PDB Compounds: (D:) xylose isomerase

SCOPe Domain Sequences for d1a0cd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a0cd_ c.1.15.3 (D:) D-xylose isomerase {Clostridium thermosulfurogenes, also known as Thermoanaerobacter thermosulfurigenes [TaxId: 33950]}
nkyfenvskikyegpksnnpysfkfynpeevidgktmeehlrfsiaywhtftadgtdqfg
katmqrpwnhytdpmdiakarveaafeffdkinapyfcfhdrdiapegdtlretnknldt
ivamikdylktsktkvlwgtanlfsnprfvhgastscnadvfaysaaqvkkaleitkelg
genyvfwggregyetllntdmefeldnfarflhmavdyakeigfegqfliepkpkeptkh
qydfdvanvlaflrkydldkyfkvnieanhatlafhdfqhelryaringvlgsidantgd
mllgwdtdqfptdirmttlamyevikmggfdkgglnfdakvrrasfepedlflghiagmd
afakgfkvayklvkdrvfdkfieeryasykdgigadivsgkadfrslekyalersqivnk
sgrqellesilnqylfa

SCOPe Domain Coordinates for d1a0cd_:

Click to download the PDB-style file with coordinates for d1a0cd_.
(The format of our PDB-style files is described here.)

Timeline for d1a0cd_: