Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.15: Xylose isomerase-like [51658] (8 families) different families share similar but non-identical metal-binding sites |
Family c.1.15.3: Xylose isomerase [51665] (2 proteins) |
Protein D-xylose isomerase [51666] (13 species) |
Species Clostridium thermosulfurogenes, also known as Thermoanaerobacter thermosulfurigenes [TaxId:33950] [51674] (1 PDB entry) |
Domain d1a0ca_: 1a0c A: [29529] complexed with co |
PDB Entry: 1a0c (more details), 2.5 Å
SCOPe Domain Sequences for d1a0ca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a0ca_ c.1.15.3 (A:) D-xylose isomerase {Clostridium thermosulfurogenes, also known as Thermoanaerobacter thermosulfurigenes [TaxId: 33950]} nkyfenvskikyegpksnnpysfkfynpeevidgktmeehlrfsiaywhtftadgtdqfg katmqrpwnhytdpmdiakarveaafeffdkinapyfcfhdrdiapegdtlretnknldt ivamikdylktsktkvlwgtanlfsnprfvhgastscnadvfaysaaqvkkaleitkelg genyvfwggregyetllntdmefeldnfarflhmavdyakeigfegqfliepkpkeptkh qydfdvanvlaflrkydldkyfkvnieanhatlafhdfqhelryaringvlgsidantgd mllgwdtdqfptdirmttlamyevikmggfdkgglnfdakvrrasfepedlflghiagmd afakgfkvayklvkdrvfdkfieeryasykdgigadivsgkadfrslekyalersqivnk sgrqellesilnqylfa
Timeline for d1a0ca_: