Lineage for d6ximb_ (6xim B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2839044Superfamily c.1.15: Xylose isomerase-like [51658] (8 families) (S)
    different families share similar but non-identical metal-binding sites
  5. 2839095Family c.1.15.3: Xylose isomerase [51665] (2 proteins)
  6. 2839096Protein D-xylose isomerase [51666] (13 species)
  7. 2839097Species Actinoplanes missouriensis [TaxId:1866] [51673] (14 PDB entries)
  8. 2839135Domain d6ximb_: 6xim B: [29518]
    complexed with mg, xls

Details for d6ximb_

PDB Entry: 6xim (more details), 2.5 Å

PDB Description: protein engineering of xylose (glucose) isomerase from actinoplanes missouriensis. 1. crystallography and site-directed mutagenesis of metal binding sites
PDB Compounds: (B:) d-xylose isomerase

SCOPe Domain Sequences for d6ximb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ximb_ c.1.15.3 (B:) D-xylose isomerase {Actinoplanes missouriensis [TaxId: 1866]}
vqatredkfsfglwtvgwqardafgdatrtaldpveavhklaeigaygitfhdddlvpfg
sdaqtrdgiiagfkkaldetglivpmvttnlfthpvfkdggftsndrsvrryairkvlrq
mdlgaelgaktlvlwggregaeydsakdvsaaldryrealnllaqysedrgyglrfaiep
kpneprgdillptaghaiafvqelerpelfginpetgheqmsnlnftqgiaqalwhkklf
hidlngqhgpkfdqdlvfghgdllnafslvdllengpdgapaydgprhfdykpsrtedyd
gvwesakanirmylllkerakafradpevqealaaskvaelktptlnpgegyaelladrs
afedydadavgakgfgfvklnqlaiehllgar

SCOPe Domain Coordinates for d6ximb_:

Click to download the PDB-style file with coordinates for d6ximb_.
(The format of our PDB-style files is described here.)

Timeline for d6ximb_: