Lineage for d3qgub_ (3qgu B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2502820Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2502821Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2504326Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2504327Protein automated matches [190151] (160 species)
    not a true protein
  7. 2504825Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [267874] (1 PDB entry)
  8. 2504827Domain d3qgub_: 3qgu B: [294707]
    automated match to d4fl0b_
    complexed with azi, gol, so4

Details for d3qgub_

PDB Entry: 3qgu (more details), 1.55 Å

PDB Description: l,l-diaminopimelate aminotransferase from chlamydomonas reinhardtii
PDB Compounds: (B:) LL-diaminopimelate aminotransferase

SCOPe Domain Sequences for d3qgub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qgub_ c.67.1.0 (B:) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
qavaqragtidvqrnenfgklragylfpeiarrrkahqeknpdakiislgigdtteplpk
yiadamakaaaglatregysgygaeqgqgalreavastfyghagraadeifisdgskcdi
ariqmmfgskptvavqdpsypvyvdtsvmmgmtgdhngtgfdgieymvcnpdnhffpdls
kakrtdiiffcspnnptgaaatraqltelvnfarkngsilvydaayalyisnpdcpktiy
eipgadevaietcsfskyagftgvrlgwtvvpkalkyangepvhadwnrvmttcfngasn
ivqagglaclqpeglkemnamikfykenaqilkttftemgfsvyggddapyiwvgfpgkp
swdvfaeilercnivttpgsgygpagegfvrasafgsrenileavrrfkeayg

SCOPe Domain Coordinates for d3qgub_:

Click to download the PDB-style file with coordinates for d3qgub_.
(The format of our PDB-style files is described here.)

Timeline for d3qgub_: