Lineage for d1rusa1 (1rus A:138-457)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 115904Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies)
  4. 117501Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (1 family) (S)
  5. 117502Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (1 protein)
  6. 117503Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [51651] (8 species)
  7. 117525Species Rhodospirillum rubrum [TaxId:1085] [51657] (5 PDB entries)
  8. 117532Domain d1rusa1: 1rus A:138-457 [29388]
    Other proteins in same PDB: d1rusa2, d1rusb2

Details for d1rusa1

PDB Entry: 1rus (more details), 2.9 Å

PDB Description: crystal structure of the binary complex of ribulose-1,5-bisphosphate carboxylase and its product, 3-phospho-d-glycerate

SCOP Domain Sequences for d1rusa1:

Sequence, based on SEQRES records: (download)

>d1rusa1 c.1.14.1 (A:138-457) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Rhodospirillum rubrum}
gpsvnisalwkvlgrpevdgglvvgtiikpklglrpkpfaeachafwlggdfikndepqg
nqpfaplrdtialvadamrraqdetgeaklfsanitaddpfeiiargeyvletfgenash
vallvdgyvagaaaittarrrfpdnflhyhraghgavtspqskrgytafvhckmarlqga
sgihtgtmgfgkmegessdraiaymltqdeaqgpfyrqswggmkactpiisggmnalrmp
gffenlgnanviltagggafghidgpvagarslrqawqawrdgvpvldyarehkelaraf
esfpgdadqiypgwrkalgv

Sequence, based on observed residues (ATOM records): (download)

>d1rusa1 c.1.14.1 (A:138-457) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Rhodospirillum rubrum}
gpsvnisalwkvlgrpevdgglvvgtiikpklglrpkpfaeachafwlggdfikndepqg
nqpfaplrdtialvadamrraqdetgeaklfsanitaddpfeiiargeyvletfgenash
vallvdgyvagaaaittarrrfpdnflhyhraghgavtspqskrgytafvhckmarlqga
sgihtgtmssdraiaymltqdeaqgpfyrqswggmkactpiisggmnalrmpgffenlgn
anviltagggafghidgpvagarslrqawqawrdgvpvldyarehkelarafesfpgdad
qiypgwrkalgv

SCOP Domain Coordinates for d1rusa1:

Click to download the PDB-style file with coordinates for d1rusa1.
(The format of our PDB-style files is described here.)

Timeline for d1rusa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rusa2