Lineage for d9rubb1 (9rub B:138-459)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 115904Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies)
  4. 117501Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (1 family) (S)
  5. 117502Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (1 protein)
  6. 117503Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [51651] (8 species)
  7. 117525Species Rhodospirillum rubrum [TaxId:1085] [51657] (5 PDB entries)
  8. 117531Domain d9rubb1: 9rub B:138-459 [29387]
    Other proteins in same PDB: d9ruba2, d9rubb2

Details for d9rubb1

PDB Entry: 9rub (more details), 2.6 Å

PDB Description: crystal structure of activated ribulose-1,5-bisphosphate carboxylase complexed with its substrate, ribulose-1,5-bisphosphate

SCOP Domain Sequences for d9rubb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d9rubb1 c.1.14.1 (B:138-459) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Rhodospirillum rubrum}
gpsvnisalwkvlgrpevdgglvvgtiikpklglrpkpfaeachafwlggdfikndepqg
nqpfaplrdtialvadamrraqdetgeaklfsanitaddpfeiiargeyvletfgenash
vallvdgyvagaaaittarrrfpdnflhyhraghgavtspqskrgytafvhckmarlqga
sgihtgtmgfgkmegessdraiaymltqdeaqgpfyrqswggmkactpiisggmnalrmp
gffenlgnanviltagggafghidgpvagarslrqawqawrdgvpvldyarehkelaraf
esfpgdadqiypgwrkalgved

SCOP Domain Coordinates for d9rubb1:

Click to download the PDB-style file with coordinates for d9rubb1.
(The format of our PDB-style files is described here.)

Timeline for d9rubb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d9rubb2