Lineage for d1rsca1 (1rsc A:148-475)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1344774Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (2 families) (S)
    automatically mapped to Pfam PF00016
  5. 1344775Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (2 proteins)
    N-terminal domain is alpha+beta
  6. 1344776Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [51651] (12 species)
  7. 1344983Species Synechococcus sp., strain pcc 6301 [TaxId:1131] [51656] (2 PDB entries)
  8. 1344992Domain d1rsca1: 1rsc A:148-475 [29381]
    Other proteins in same PDB: d1rsca2, d1rscb2, d1rscc2, d1rscd2, d1rsce2, d1rscf2, d1rscg2, d1rsch2, d1rsci_, d1rscj_, d1rsck_, d1rscl_, d1rscm_, d1rscn_, d1rsco_, d1rscp_
    complexed with xbp

Details for d1rsca1

PDB Entry: 1rsc (more details), 2.3 Å

PDB Description: structure of an effector induced inactivated state of ribulose bisphosphate carboxylase(slash)oxygenase: the binary complex between enzyme and xylulose bisphosphate
PDB Compounds: (A:) ribulose 1,5 bisphosphate carboxylase/oxygenase (large chain)

SCOPe Domain Sequences for d1rsca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rsca1 c.1.14.1 (A:148-475) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Synechococcus sp., strain pcc 6301 [TaxId: 1131]}
fqgpphgiqverdllnkygrpmlgctikpklglsaknygravyeclrggldftkddenin
sqpfqrwrdrflfvadaihksqaetgeikghylnvtaptceemmkraefakelgmpiimh
dfltagftanttlakwcrdngvllhihramhavidrqrnhgihfrvlakclrlsggdhlh
sgtvvgklegdkastlgfvdlmredhieadrsrgvfftqdwasmpgvlpvasggihvwhm
palveifgddsvlqfgggtlghpwgnapgatanrvaleacvqarnegrdlyreggdilre
agkwspelaaaldlwkeikfefetmdkl

SCOPe Domain Coordinates for d1rsca1:

Click to download the PDB-style file with coordinates for d1rsca1.
(The format of our PDB-style files is described here.)

Timeline for d1rsca1: