Lineage for d1bwvg1 (1bwv G:150-478)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1565956Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1574721Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (2 families) (S)
    automatically mapped to Pfam PF00016
  5. 1574722Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (2 proteins)
    N-terminal domain is alpha+beta
  6. 1574723Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [51651] (12 species)
  7. 1574734Species Galdieria partita [TaxId:83374] [51654] (2 PDB entries)
  8. 1574738Domain d1bwvg1: 1bwv G:150-478 [29375]
    Other proteins in same PDB: d1bwva2, d1bwvc2, d1bwve2, d1bwvg2, d1bwvs_, d1bwvu_, d1bwvw_, d1bwvy_
    complexed with cap, mg

Details for d1bwvg1

PDB Entry: 1bwv (more details), 2.4 Å

PDB Description: Activated Ribulose 1,5-Bisphosphate Carboxylase/Oxygenase (RUBISCO) Complexed with the Reaction Intermediate Analogue 2-Carboxyarabinitol 1,5-Bisphosphate
PDB Compounds: (G:) protein (ribulose bisphosphate carboxylase)

SCOPe Domain Sequences for d1bwvg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bwvg1 c.1.14.1 (G:150-478) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Galdieria partita [TaxId: 83374]}
gpatgvilererldkfgrpllgcttkpklglsgknygrvvyealkggldfvkddeninsq
pfmrwrerylftmeavnkasaatgevkghylnvtaatmeemyaranfakelgsviimidl
vigytaiqtmakwardndmilhlhragnstysrqknhgmnfrvickwmrmagvdhihagt
vvgklegdpiitrgfyktlllpklernlqeglffdmewaslrkvmpvasggihagqmhql
ihylgedvvlqfgggtighpdgiqagatanrvaleamilarnenrdyltegpeilreaak
tcgalrtaldlwkditfnytstdtsdfv

SCOPe Domain Coordinates for d1bwvg1:

Click to download the PDB-style file with coordinates for d1bwvg1.
(The format of our PDB-style files is described here.)

Timeline for d1bwvg1: