Lineage for d1rcov1 (1rco V:148-475)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 115904Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies)
  4. 117501Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (1 family) (S)
  5. 117502Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (1 protein)
  6. 117503Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [51651] (8 species)
  7. 117536Species Spinach (Spinacia oleracea) [TaxId:3562] [51653] (8 PDB entries)
  8. 117565Domain d1rcov1: 1rco V:148-475 [29363]
    Other proteins in same PDB: d1rcob2, d1rcoc_, d1rcoe2, d1rcof_, d1rcoh2, d1rcoi_, d1rcok2, d1rcol2, d1rcom_, d1rcoo2, d1rcop_, d1rcor2, d1rcos_, d1rcot_, d1rcov2, d1rcow_

Details for d1rcov1

PDB Entry: 1rco (more details), 2.3 Å

PDB Description: spinach rubisco in complex with the inhibitor d-xylulose-2,2-diol-1,5-bisphosphate

SCOP Domain Sequences for d1rcov1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rcov1 c.1.14.1 (V:148-475) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Spinach (Spinacia oleracea)}
fqgpphgiqverdklnkygrpllgctikpklglsaknygravyeclrggldftkddenvn
sqpfmrwrdrflfcaealykaqaetgeikghylnatagtcedmmkravfarelgvpivmh
dyltggftanttlshycrdnglllhihramhavidrqknhgmhfrvlakalrlsggdhih
sgtvvgklegerditlgfvdllrddytekdrsrgiyftqswvstpgvlpvasggihvwhm
palteifgddsvlqfgggtlghpwgnapgavanrvaleacvqarnegrdlaregntiire
atkwspelaaacevwkeikfefpamdtv

SCOP Domain Coordinates for d1rcov1:

Click to download the PDB-style file with coordinates for d1rcov1.
(The format of our PDB-style files is described here.)

Timeline for d1rcov1: