Lineage for d1aa1l1 (1aa1 L:148-463)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 115904Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies)
  4. 117501Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (1 family) (S)
  5. 117502Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (1 protein)
  6. 117503Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [51651] (8 species)
  7. 117536Species Spinach (Spinacia oleracea) [TaxId:3562] [51653] (8 PDB entries)
  8. 117552Domain d1aa1l1: 1aa1 L:148-463 [29347]
    Other proteins in same PDB: d1aa1b2, d1aa1c_, d1aa1e2, d1aa1f_, d1aa1h2, d1aa1i_, d1aa1l2, d1aa1s_

Details for d1aa1l1

PDB Entry: 1aa1 (more details), 2.2 Å

PDB Description: activated spinach rubisco in complex with the product 3-phosphoglycerate

SCOP Domain Sequences for d1aa1l1:

Sequence, based on SEQRES records: (download)

>d1aa1l1 c.1.14.1 (L:148-463) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Spinach (Spinacia oleracea)}
fqgpphgiqverdklnkygrpllgctikpklglsaknygravyeclrggldftkddenvn
sqpfmrwrdrflfcaealykaqaetgeikghylnatagtcedmmkravfarelgvpivmh
dyltggftanttlshycrdnglllhihramhavidrqknhgmhfrvlakalrlsggdhih
sgtvvgklegerditlgfvdllrddytekdrsrgiyftqswvstpgvlpvasggihvwhm
palteifgddsvlqfgggtlghpwgnapgavanrvaleacvqarnegrdlaregntiire
atkwspelaaacevwk

Sequence, based on observed residues (ATOM records): (download)

>d1aa1l1 c.1.14.1 (L:148-463) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Spinach (Spinacia oleracea)}
fqgpphgiqverdklnkygrpllgctikpklglsaknygravyeclrggldftkddenvn
sqpfmrwrdrflfcaealykaqaetgeikghylnatagtcedmmkravfarelgvpivmh
dyltggftanttlshycrdnglllhihramhavidrqknhgmhfrvlakalrlsggdhih
sgtvverditlgfvdllrddytekdrsrgiyftqswvstpgvlpvasggihvwhmpalte
ifgddsvlqfgggtlghpwgnapgavanrvaleacvqarnegrdlaregntiireatkws
pelaaacevwk

SCOP Domain Coordinates for d1aa1l1:

Click to download the PDB-style file with coordinates for d1aa1l1.
(The format of our PDB-style files is described here.)

Timeline for d1aa1l1: