SCOP 1.61: Domain d1rboh1: 1rbo H:148-475

Lineage for d1rboh1 (1rbo H:148-475)

Root: SCOP 1.61
Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
Fold c.1: TIM beta/alpha-barrel [51350] (25 superfamilies)
Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (1 family)
Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (1 protein)
Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [51651] (8 species)
Species Spinach (Spinacia oleracea) [TaxId:3562] [51653] (8 PDB entries)
Domain d1rboh1: 1rbo H:148-475 [29346]
Other proteins in same PDB: d1rbob2, d1rboc_, d1rboe2, d1rbof_, d1rboh2, d1rboi_, d1rbol2, d1rbos_

Details for d1rboh1

PDB Entry: 1rbo (more details), 2.3 Å

PDB Description: spinach rubisco in complex with the inhibitor 2-carboxyarabinitol-1,5- diphosphate

SCOP Domain Sequences for d1rboh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rboh1 c.1.14.1 (H:148-475) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Spinach (Spinacia oleracea)}
fqgpphgiqverdklnkygrpllgctikpklglsaknygravyeclrggldftkddenvn
sqpfmrwrdrflfcaealykaqaetgeikghylnatagtcedmmkravfarelgvpivmh
dyltggftanttlshycrdnglllhihramhavidrqknhgmhfrvlakalrlsggdhih
sgtvvgklegerditlgfvdllrddytekdrsrgiyftqswvstpgvlpvasggihvwhm
palteifgddsvlqfgggtlghpwgnapgavanrvaleacvqarnegrdlaregntiire
atkwspelaaacevwkeikfefpamdtv

SCOP Domain Coordinates for d1rboh1:

Click to download the PDB-style file with coordinates for d1rboh1.
(The format of our PDB-style files is described here.)

Timeline for d1rboh1: