SCOPe 2.08: Domain d1rbob1: 1rbo B:148-475

Lineage for d1rbob1 (1rbo B:148-475)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (2 families)
   automatically mapped to Pfam PF00016

5. Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (2 proteins)
   N-terminal domain is alpha+beta

6. Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [51651] (14 species)

7. Species Spinach (Spinacia oleracea) [TaxId:3562] [51653] (11 PDB entries)

8. Domain d1rbob1: 1rbo B:148-475 [29344]
   Other proteins in same PDB: d1rbob2, d1rboc_, d1rboe2, d1rbof_, d1rboh2, d1rboi_, d1rbol2, d1rbos_
   complexed with cap

Details for d1rbob1

PDB Entry: 1rbo, 2.3 Å

PDB Description: spinach rubisco in complex with the inhibitor 2-carboxyarabinitol-1,5- diphosphate

PDB Compounds: (B:) ribulose bisphosphate carboxylase/oxygenase

SCOPe Domain Sequences for d1rbob1:

Sequence; same for both SEQRES and ATOM records:

>d1rbob1 c.1.14.1 (B:148-475) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Spinach (Spinacia oleracea) [TaxId: 3562]}
fqgpphgiqverdklnkygrpllgctikpklglsaknygravyeclrggldftkddenvn
sqpfmrwrdrflfcaealykaqaetgeikghylnatagtcedmmkravfarelgvpivmh
dyltggftanttlshycrdnglllhihramhavidrqknhgmhfrvlakalrlsggdhih
sgtvvgklegerditlgfvdllrddytekdrsrgiyftqswvstpgvlpvasggihvwhm
palteifgddsvlqfgggtlghpwgnapgavanrvaleacvqarnegrdlaregntiire
atkwspelaaacevwkeikfefpamdtv

Timeline for d1rbob1:

• d1rbob1 first appeared (with stable ids) in SCOP 1.55
  
• d1rbob1 appears in SCOPe 2.07