Lineage for d8rucg1 (8ruc G:148-475)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 968086Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 973964Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (1 family) (S)
  5. 973965Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (1 protein)
    N-terminal domain is alpha+beta
  6. 973966Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [51651] (12 species)
  7. 974110Species Spinach (Spinacia oleracea) [TaxId:3562] [51653] (8 PDB entries)
  8. 974114Domain d8rucg1: 8ruc G:148-475 [29342]
    Other proteins in same PDB: d8ruca2, d8rucc2, d8ruce2, d8rucg2, d8ruci_, d8rucj_, d8ruck_, d8rucl_
    complexed with cap, mg

Details for d8rucg1

PDB Entry: 8ruc (more details), 1.6 Å

PDB Description: activated spinach rubisco complexed with 2-carboxyarabinitol bisphosphate
PDB Compounds: (G:) ribulose-1,5-bisphosphate carboxylase/oxygenase

SCOPe Domain Sequences for d8rucg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d8rucg1 c.1.14.1 (G:148-475) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Spinach (Spinacia oleracea) [TaxId: 3562]}
fqgpphgiqverdklnkygrpllgctikpklglsaknygravyeclrggldftkddenvn
sqpfmrwrdrflfcaealykaqaetgeikghylnatagtcedmmkravfarelgvpivmh
dyltggftanttlshycrdnglllhihramhavidrqknhgmhfrvlakalrlsggdhih
sgtvvgklegerditlgfvdllrddytekdrsrgiyftqswvstpgvlpvasggihvwhm
palteifgddsvlqfgggtlghpwgnapgavanrvaleacvqarnegrdlaregntiire
atkwspelaaacevwkeikfefpamdtv

SCOPe Domain Coordinates for d8rucg1:

Click to download the PDB-style file with coordinates for d8rucg1.
(The format of our PDB-style files is described here.)

Timeline for d8rucg1: