Lineage for d8rucg1 (8ruc G:148-475)
- Root: SCOP 1.57
Class c: Alpha and beta proteins (a/b) [51349] (107 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies) 
Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (1 family) 
Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (1 protein) Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [51651] (6 species) Species Spinach (Spinacia oleracea) [TaxId:3562] [51653] (8 PDB entries) 
Domain d8rucg1: 8ruc G:148-475 [29342]
Other proteins in same PDB: d8ruca2, d8rucc2, d8ruce2, d8rucg2, d8ruci_, d8rucj_, d8ruck_, d8rucl_
Details for d8rucg1
PDB Entry: 8ruc (more details), 1.6 Å
PDB Description: activated spinach rubisco complexed with 2-carboxyarabinitol bisphosphate
SCOP Domain Sequences for d8rucg1:
Sequence; same for both SEQRES and ATOM records: (download)
>d8rucg1 c.1.14.1 (G:148-475) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Spinach (Spinacia oleracea)}
fqgpphgiqverdklnkygrpllgctikpklglsaknygravyeclrggldftkddenvn
sqpfmrwrdrflfcaealykaqaetgeikghylnatagtcedmmkravfarelgvpivmh
dyltggftanttlshycrdnglllhihramhavidrqknhgmhfrvlakalrlsggdhih
sgtvvgklegerditlgfvdllrddytekdrsrgiyftqswvstpgvlpvasggihvwhm
palteifgddsvlqfgggtlghpwgnapgavanrvaleacvqarnegrdlaregntiire
atkwspelaaacevwkeikfefpamdtv
SCOP Domain Coordinates for d8rucg1:
Click to download the PDB-style file with coordinates for d8rucg1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d8rucg1:
View in 3D
