Lineage for d8ruce1 (8ruc E:148-475)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 18353Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies)
  4. 19539Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (1 family) (S)
  5. 19540Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (1 protein)
  6. 19541Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [51651] (6 species)
  7. 19563Species Spinach (Spinacia oleracea) [TaxId:3562] [51653] (8 PDB entries)
  8. 19570Domain d8ruce1: 8ruc E:148-475 [29341]
    Other proteins in same PDB: d8ruca2, d8rucc2, d8ruce2, d8rucg2, d8ruci_, d8rucj_, d8ruck_, d8rucl_

Details for d8ruce1

PDB Entry: 8ruc (more details), 1.6 Å

PDB Description: activated spinach rubisco complexed with 2-carboxyarabinitol bisphosphate

SCOP Domain Sequences for d8ruce1:

Sequence; same for both SEQRES and ATOM records: (download)

>d8ruce1 c.1.14.1 (E:148-475) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Spinach (Spinacia oleracea)}
fqgpphgiqverdklnkygrpllgctikpklglsaknygravyeclrggldftkddenvn
sqpfmrwrdrflfcaealykaqaetgeikghylnatagtcedmmkravfarelgvpivmh
dyltggftanttlshycrdnglllhihramhavidrqknhgmhfrvlakalrlsggdhih
sgtvvgklegerditlgfvdllrddytekdrsrgiyftqswvstpgvlpvasggihvwhm
palteifgddsvlqfgggtlghpwgnapgavanrvaleacvqarnegrdlaregntiire
atkwspelaaacevwkeikfefpamdtv

SCOP Domain Coordinates for d8ruce1:

Click to download the PDB-style file with coordinates for d8ruce1.
(The format of our PDB-style files is described here.)

Timeline for d8ruce1: