Lineage for d1burc1 (1bur C:148-475)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 64292Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies)
  4. 65680Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (1 family) (S)
  5. 65681Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (1 protein)
  6. 65682Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [51651] (6 species)
  7. 65704Species Spinach (Spinacia oleracea) [TaxId:3562] [51653] (8 PDB entries)
  8. 65707Domain d1burc1: 1bur C:148-475 [29337]
    Other proteins in same PDB: d1bura2, d1burb2, d1burc2, d1burd2, d1burs_, d1burt_, d1buru_, d1burv_

Details for d1burc1

PDB Entry: 1bur (more details), 1.8 Å

PDB Description: ribulose 1,5-bisphosphate carboxylase/oxygenase complexed with carbon dioxide, mg2+ and 2-carboxyarabinitol-1,5-bisphosphate

SCOP Domain Sequences for d1burc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1burc1 c.1.14.1 (C:148-475) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Spinach (Spinacia oleracea)}
fqgpphgiqverdklnkygrpllgctikpklglsaknygravyeclrggldftkddenvn
sqpfmrwrdrflfcaealykaqaetgeikghylnatagtcedmmkravfarelgvpivmh
dyltggftanttlshycrdnglllhihramhavidrqknhgmhfrvlakalrlsggdhih
sgtvvgklegerditlgfvdllrddytekdrsrgiyftqswvstpgvlpvasggihvwhm
palteifgddsvlqfgggtlghpwgnapgavanrvaleacvqarnegrdlaregntiire
atkwspelaaacevwkeikfefpamdtv

SCOP Domain Coordinates for d1burc1:

Click to download the PDB-style file with coordinates for d1burc1.
(The format of our PDB-style files is described here.)

Timeline for d1burc1: