Lineage for d4ruba1 (4rub A:148-473)
- Root: SCOP 1.57
Class c: Alpha and beta proteins (a/b) [51349] (107 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies) 
Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (1 family) 
Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (1 protein) Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [51651] (6 species) 
Species Tobacco (Nicotiana tabacum), variant turkish samsun [TaxId:4097] [51652] (5 PDB entries) 
Domain d4ruba1: 4rub A:148-473 [29331]
Other proteins in same PDB: d4ruba2, d4rubb2, d4rubc2, d4rubd2, d4rubs_, d4rubt_, d4rubu_, d4rubv_
Details for d4ruba1
PDB Entry: 4rub (more details), 2.7 Å
PDB Description: a crystal form of ribulose-1,5-bisphosphate carboxylase(slash)oxygenase from nicotiana tabacum in the activated state
SCOP Domain Sequences for d4ruba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ruba1 c.1.14.1 (A:148-473) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Tobacco (Nicotiana tabacum), variant turkish samsun}
fqgpphgiqverdklnkygrpllgctikpklglsaknygravyeclrggldftkddenvn
sqpfmrwrdrflfcaealykaqaetgeikghylnatagtceemikravfarelgvpivmh
dyltggftantslahycrdnglllhihramhavidrqknhgihfrvlakalrmsggdhih
sgtvvgklegerditlgfvdllrddfveqdrsrgiyftqdwvslpgvlpvasggihvwhm
palteifgddsvlqfgggtlghpwgnapgavanrvaleacvkarnegrdlaqegneiire
ackwspelaaacevwkeivfnfaavd
SCOP Domain Coordinates for d4ruba1:
Click to download the PDB-style file with coordinates for d4ruba1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4ruba1:
View in 3D
