Lineage for d1rlcl1 (1rlc L:148-467)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1824891Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (2 families) (S)
    automatically mapped to Pfam PF00016
  5. 1824892Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (2 proteins)
    N-terminal domain is alpha+beta
  6. 1824893Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [51651] (12 species)
  7. 1825077Species Tobacco (Nicotiana tabacum), variant turkish samsun [TaxId:4097] [51652] (5 PDB entries)
  8. 1825082Domain d1rlcl1: 1rlc L:148-467 [29330]
    Other proteins in same PDB: d1rlcl2, d1rlcs_
    complexed with cap

Details for d1rlcl1

PDB Entry: 1rlc (more details), 2.7 Å

PDB Description: crystal structure of the unactivated ribulose 1, 5-bisphosphate carboxylase(slash)oxygenase complexed with a transition state analog, 2-carboxy-d-arabinitol 1,5-bisphosphate
PDB Compounds: (L:) ribulose 1,5 bisphosphate carboxylase/oxygenase (large chain)

SCOPe Domain Sequences for d1rlcl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rlcl1 c.1.14.1 (L:148-467) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Tobacco (Nicotiana tabacum), variant turkish samsun [TaxId: 4097]}
fqgpphgiqverdklnkygrpllgctikpklglsaknygravyeclrggldftkddenvn
sqpfmrwrdrflfcaealykaqaetgeikghylnatagtceemikravfarelgvpivmh
dyltggftantslahycrdnglllhihramhavidrqknhgihfrvlakalrmsggdhih
sgtvvgklegerditlgfvdllrddfveqdrsrgiyftqdwvslpgvlpvasggihvwhm
palteifgddsvlqfgggtlghpwgnapgavanrvaleacvkarnegrdlaqegneiire
ackwspelaaacevwkeivf

SCOPe Domain Coordinates for d1rlcl1:

Click to download the PDB-style file with coordinates for d1rlcl1.
(The format of our PDB-style files is described here.)

Timeline for d1rlcl1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rlcl2
View in 3D
Domains from other chains:
(mouse over for more information)
d1rlcs_