Lineage for d1ej7l1 (1ej7 L:148-474)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 64292Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies)
  4. 65680Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (1 family) (S)
  5. 65681Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (1 protein)
  6. 65682Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [51651] (6 species)
  7. 65745Species Tobacco (Nicotiana tabacum), variant turkish samsun [TaxId:4097] [51652] (5 PDB entries)
  8. 65747Domain d1ej7l1: 1ej7 L:148-474 [29327]
    Other proteins in same PDB: d1ej7l2, d1ej7s_

Details for d1ej7l1

PDB Entry: 1ej7 (more details), 2.45 Å

PDB Description: crystal structure of unactivated tobacco rubisco with bound phosphate ions

SCOP Domain Sequences for d1ej7l1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ej7l1 c.1.14.1 (L:148-474) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Tobacco (Nicotiana tabacum), variant turkish samsun}
fqgpphgiqverdklnkygrpllgctikpklglsaknygravyeclrggldftkddenvn
sqpfmrwrdrflfcaealykaqaetgeikghylnatagtceemikravfarelgvpivmh
dyltggftantslahycrdnglllhihramhavidrqknhgihfrvlakalrmsggdhih
sgtvvgklegerditlgfvdllrddfveqdrsrgiyftqdwvslpgvlpvasggihvwhm
palteifgddsvlqfgggtlghpwgnapgavanrvaleacvkarnegrdlaqegneiire
ackwspelaaacevwkeivfnfaavdv

SCOP Domain Coordinates for d1ej7l1:

Click to download the PDB-style file with coordinates for d1ej7l1.
(The format of our PDB-style files is described here.)

Timeline for d1ej7l1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ej7l2
View in 3D
Domains from other chains:
(mouse over for more information)
d1ej7s_