Lineage for d1pkle2 (1pkl E:1-87,E:187-357)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 64292Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies)
  4. 65575Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (6 families) (S)
  5. 65576Family c.1.12.1: Pyruvate kinase [51622] (1 protein)
  6. 65577Protein Pyruvate kinase, N-terminal domain [51623] (5 species)
  7. 65598Species Leishmania mexicana [TaxId:5665] [51626] (1 PDB entry)
  8. 65603Domain d1pkle2: 1pkl E:1-87,E:187-357 [29284]
    Other proteins in same PDB: d1pkla1, d1pkla3, d1pklb1, d1pklb3, d1pklc1, d1pklc3, d1pkld1, d1pkld3, d1pkle1, d1pkle3, d1pklf1, d1pklf3, d1pklg1, d1pklg3, d1pklh1, d1pklh3

Details for d1pkle2

PDB Entry: 1pkl (more details), 2.35 Å

PDB Description: the structure of leishmania pyruvate kinase

SCOP Domain Sequences for d1pkle2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pkle2 c.1.12.1 (E:1-87,E:187-357) Pyruvate kinase, N-terminal domain {Leishmania mexicana}
sqlahnltlsifdpvanyraariictigpstqsvealkgliqsgmsvarmnfshgsheyh
qttinnvrqaaaelgvniaialdtkgpXpavsakdrvdlqfgveqgvdmifasfirsaeq
vgdvrkalgpkgrdimiickienhqgvqnidsiieesdgimvargdlgveipaekvvvaq
kiliskcnvagkpvicatqmlesmtynprptraevsdvanavfngadcvmlsgetakgky
pnevvqymaricleaqsal

SCOP Domain Coordinates for d1pkle2:

Click to download the PDB-style file with coordinates for d1pkle2.
(The format of our PDB-style files is described here.)

Timeline for d1pkle2: