![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) ![]() binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
![]() | Family c.1.11.2: D-glucarate dehydratase-like [51609] (15 proteins) |
![]() | Protein Muconate-lactonizing enzyme [51615] (1 species) |
![]() | Species Pseudomonas putida [TaxId:303] [51616] (5 PDB entries) |
![]() | Domain d3mucb1: 3muc B:131-372 [29244] Other proteins in same PDB: d3muca2, d3mucb2 complexed with mn |
PDB Entry: 3muc (more details), 2.3 Å
SCOPe Domain Sequences for d3mucb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mucb1 c.1.11.2 (B:131-372) Muconate-lactonizing enzyme {Pseudomonas putida [TaxId: 303]} rvrdslevawtlasgdtardiaearhmleirrhrvfklkiganpveqdlkhvvtikrelg dsasvrvdvnqywdesqairacqvlgdngidlieqpisrinrggqvrlnqrtpapimade siesvedafslaadgaasifalkiaknggpravlrtaqiaeaagiglyggtmlegsigtl asahafltlrqltwgtelfgplllteeivneppqyrdfqlhiprtpglgltldeqrlarf ar
Timeline for d3mucb1: