Lineage for d3fwck_ (3fwc K:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2739463Fold a.301: Sus1-like [310571] (1 superfamily)
    5 helices; articulated hairpin fold
  4. 2739464Superfamily a.301.1: Sus1-like [310603] (1 family) (S)
    Pfam PF10163
    interactions with Sac3, Cdc31 described in PubMed 19328066
  5. 2739465Family a.301.1.1: Sus1-like [310653] (3 proteins)
  6. 2739472Protein Sus1 [310814] (1 species)
  7. 2739473Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [311080] (14 PDB entries)
  8. 2739493Domain d3fwck_: 3fwc K: [292332]
    Other proteins in same PDB: d3fwca_, d3fwce_, d3fwci_, d3fwcm_
    automated match to d3fwbc_
    protein/RNA complex; complexed with so4

Details for d3fwck_

PDB Entry: 3fwc (more details), 2.7 Å

PDB Description: Sac3:Sus1:Cdc31 complex
PDB Compounds: (K:) Protein SUS1

SCOPe Domain Sequences for d3fwck_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fwck_ a.301.1.1 (K:) Sus1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
aqlksqiqqylvesgnyelisnelkarllqegwvdkvkdltksemninestnftqilstv
epkalemvsdstretvlkqirefleeiv

SCOPe Domain Coordinates for d3fwck_:

Click to download the PDB-style file with coordinates for d3fwck_.
(The format of our PDB-style files is described here.)

Timeline for d3fwck_: