SCOPe 2.06: Domain d1ec8b1: 1ec8 B:138-446

Lineage for d1ec8b1 (1ec8 B:138-446)

Root: SCOPe 2.06
Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites

Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families)

binds metal ion (magnesium or manganese) in conserved site inside barrel
N-terminal alpha+beta domain is common to this superfamily

Family c.1.11.2: D-glucarate dehydratase-like [51609] (15 proteins)
Protein D-glucarate dehydratase [51610] (2 species)
Species Escherichia coli [TaxId:562] [51612] (7 PDB entries)
Domain d1ec8b1: 1ec8 B:138-446 [29223]
Other proteins in same PDB: d1ec8a2, d1ec8b2, d1ec8c2, d1ec8d2
complexed with glr, ipa, mg

Details for d1ec8b1

PDB Entry: 1ec8 (more details), 1.9 Å

PDB Description: e. coli glucarate dehydratase bound to product 2,3-dihydroxy-5-oxo- hexanedioate

PDB Compounds: (B:) glucarate dehydratase

SCOPe Domain Sequences for d1ec8b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ec8b1 c.1.11.2 (B:138-446) D-glucarate dehydratase {Escherichia coli [TaxId: 562]}
dgqqrsevemlgylffvgnrkatplpyqsqpddscdwyrlrheeamtpdavvrlaeaaye
kygfndfklkggvlageeeaesivalaqrfpqaritldpngawslneaikigkylkgsla
yaedpcgaeqgfsgrevmaefrratglptatnmiatdwrqmghtlslqsvdipladphfw
tmqgsvrvaqmchefgltwgshsnnhfdislamfthvaaaapgkitaidthwiwqegnqr
ltkepfeikgglvqvpekpglgveidmdqvmkahelyqkhglgarddamgmqylipgwtf
dnkrpcmvr

SCOPe Domain Coordinates for d1ec8b1:

Click to download the PDB-style file with coordinates for d1ec8b1.
(The format of our PDB-style files is described here.)

Timeline for d1ec8b1: