![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.11: Enolase C-terminal domain-like [51604] (2 families) ![]() binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
![]() | Family c.1.11.1: Enolase [51605] (1 protein) |
![]() | Protein Enolase [51606] (8 species) Fold of this protein slightly differs from common fold in topology |
![]() | Species European lobster (Homarus vulgaris) [TaxId:6707] [51608] (2 PDB entries) |
![]() | Domain d1pdya1: 1pdy A:140-433 [29216] Other proteins in same PDB: d1pdya2 complexed with so4 |
PDB Entry: 1pdy (more details), 2.4 Å
SCOP Domain Sequences for d1pdya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pdya1 c.1.11.1 (A:140-433) Enolase {European lobster (Homarus vulgaris) [TaxId: 6707]} devilpvpafnvinggshagnklamqefmilptgatsfteamrmgtevyhhlkavikarf gldatavgdeggfapnilnnkdaldliqeaikkagytgkieigmdvaasefykqnniydl dfktanndgsqkisgdqlrdmymefckdfpivsiedpfdqddwetwskmtsgttiqivgd dltvtnpkrittavekkackclllkvnqigsvtesidahllakkngwgtmvshrsgeted cfiadlvvglctgqiktgapcrserlakynqilrieeelgsgakfagknfraps
Timeline for d1pdya1: