Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (2 families) binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
Family c.1.11.1: Enolase [51605] (1 protein) |
Protein Enolase [51606] (6 species) Fold of this protein slightly differs from common fold in topology |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [51607] (14 PDB entries) |
Domain d1nel_1: 1nel 142-436 [29214] Other proteins in same PDB: d1nel_2 complexed with f f, mg, po4 |
PDB Entry: 1nel (more details), 2.6 Å
SCOP Domain Sequences for d1nel_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nel_1 c.1.11.1 (142-436) Enolase {Baker's yeast (Saccharomyces cerevisiae)} spyvlpvpflnvlnggshaggalalqefmiaptgaktfaealrigsevyhnlksltkkry gasagnvgdeggvapniqtaeealdlivdaikaaghdgkvkigldcasseffkdgkydld fknpnsdkskwltgpqladlyhslmkrypivsiedpfaeddweawshffktagiqivadd ltvtnpkriataiekkaadalllkvnqigtlsesikaaqdsfaagwgvmvshrsgetedt fiadlvvglrtgqiktgaparserlaklnqllrieeelgdnavfagenfhhgdkl
Timeline for d1nel_1: