Lineage for d7enl_1 (7enl 142-436)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 305036Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 307002Superfamily c.1.11: Enolase C-terminal domain-like [51604] (2 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this family
  5. 307003Family c.1.11.1: Enolase [51605] (1 protein)
  6. 307004Protein Enolase [51606] (5 species)
    Fold of this protein slightly differs from common fold in topology
  7. 307005Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [51607] (12 PDB entries)
  8. 307018Domain d7enl_1: 7enl 142-436 [29212]
    Other proteins in same PDB: d7enl_2
    complexed with 2pg, mg

Details for d7enl_1

PDB Entry: 7enl (more details), 2.2 Å

PDB Description: mechanism of enolase: the crystal structure of enolase-mg2+- phosphoglycerate(slash) phosphoenolpyruvate complex at 2.2-angstroms resolution
PDB Compounds: ( :)

SCOP Domain Sequences for d7enl_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7enl_1 c.1.11.1 (142-436) Enolase {Baker's yeast (Saccharomyces cerevisiae)}
spyvlpvpflnvlnggshaggalalqefmiaptgaktfaealrigsevyhnlksltkkry
gasagnvgdeggvapniqtaeealdlivdaikaaghdgkvkigldcasseffkdgkydld
fknpnsdkskwltgpqladlyhslmkrypivsiedpfaeddweawshffktagiqivadd
ltvtnpkriataiekkaadalllkvnqigtlsesikaaqdsfaagwgvmvshrsgetedt
fiadlvvglrtgqiktgaparserlaklnqllrieeelgdnavfagenfhhgdkl

SCOP Domain Coordinates for d7enl_1:

Click to download the PDB-style file with coordinates for d7enl_1.
(The format of our PDB-style files is described here.)

Timeline for d7enl_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d7enl_2