![]() | Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (28 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.11: Enolase C-terminal domain-like [51604] (2 families) ![]() binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this family |
![]() | Family c.1.11.1: Enolase [51605] (1 protein) |
![]() | Protein Enolase [51606] (5 species) Fold of this protein slightly differs from common fold in topology |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [51607] (14 PDB entries) |
![]() | Domain d6enl_1: 6enl 142-436 [29208] Other proteins in same PDB: d6enl_2 complexed with 2pl, zn |
PDB Entry: 6enl (more details), 2.2 Å
SCOP Domain Sequences for d6enl_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6enl_1 c.1.11.1 (142-436) Enolase {Baker's yeast (Saccharomyces cerevisiae)} spyvlpvpflnvlnggshaggalalqefmiaptgaktfaealrigsevyhnlksltkkry gasagnvgdeggvapniqtaeealdlivdaikaaghdgkvkigldcasseffkdgkydld fknpnsdkskwltgpqladlyhslmkrypivsiedpfaeddweawshffktagiqivadd ltvtnpkriataiekkaadalllkvnqigtlsesikaaqdsfaagwgvmvshrsgetedt fiadlvvglrtgqiktgaparserlaklnqllrieeelgdnavfagenfhhgdkl
Timeline for d6enl_1: