SCOP 1.63: Domain d1ebhb1: 1ebh B:142-436

Lineage for d1ebhb1 (1ebh B:142-436)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (2 families)
   binds metal ion (magnesium or manganese) in conserved site inside barrel
   N-terminal alpha+beta domain is common to this family

5. Family c.1.11.1: Enolase [51605] (1 protein)

6. Protein Enolase [51606] (3 species)
   Fold of this protein slightly differs from common fold in topology

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [51607] (12 PDB entries)

8. Domain d1ebhb1: 1ebh B:142-436 [29206]
   Other proteins in same PDB: d1ebha2, d1ebhb2
   complexed with cl, mg

Details for d1ebhb1

PDB Entry: 1ebh, 1.9 Å

PDB Description: octahedral coordination at the high affinity metal site in enolase; crystallographic analysis of the mg++-enzyme from yeast at 1.9 angstroms resolution

SCOP Domain Sequences for d1ebhb1:

Sequence; same for both SEQRES and ATOM records:

>d1ebhb1 c.1.11.1 (B:142-436) Enolase {Baker's yeast (Saccharomyces cerevisiae)}
spyvlpvpflnvlnggshaggalalqefmiaptgaktfaealrigsevyhnlksltkkry
gasagnvgdeggvapniqtaeealdlivdaikaaghdgkvkigldcasseffkdgkydld
fknpnsdkskwltgpqladlyhslmkrypivsiedpfaeddweawshffktagiqivadd
ltvtnpkriataiekkaadalllkvnqigtlsesikaaqdsfaagwgvmvshrsgetedt
fiadlvvglrtgqiktgaparserlaklnqllrieeelgdnavfagenfhhgdkl

Timeline for d1ebhb1:

• d1ebhb1 first appeared (with stable ids) in SCOP 1.55
  
• d1ebhb1 appears in SCOP 1.61
  
• d1ebhb1 appears in SCOP 1.65
  
• d1ebhb1 appears in the current release, SCOPe 2.08