Lineage for d1onea1 (1one A:142-436)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 64292Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies)
  4. 65496Superfamily c.1.11: Enolase C-terminal domain-like [51604] (2 families) (S)
  5. 65497Family c.1.11.1: Enolase [51605] (1 protein)
  6. 65498Protein Enolase [51606] (2 species)
  7. 65499Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [51607] (11 PDB entries)
  8. 65500Domain d1onea1: 1one A:142-436 [29200]
    Other proteins in same PDB: d1onea2, d1oneb2

Details for d1onea1

PDB Entry: 1one (more details), 1.8 Å

PDB Description: yeast enolase complexed with an equilibrium mixture of 2'-phosphoglyceate and phosphoenolpyruvate

SCOP Domain Sequences for d1onea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1onea1 c.1.11.1 (A:142-436) Enolase {Baker's yeast (Saccharomyces cerevisiae)}
spyvlpvpflnvlnggshaggalalqefmiaptgaktfaealrigsevyhnlksltkkry
gasagnvgdeggvapniqtaeealdlivdaikaaghdgkvkigldcasseffkdgkydld
fknpnsdkskwltgpqladlyhslmkrypivsiedpfaeddweawshffktagiqivadd
ltvtnpkriataiekkaadalllkvnqigtlsesikaaqdsfaagwgvmvshrsgetedt
fiadlvvglrtgqiktgaparserlaklnqllrieeelgdnavfagenfhhgdkl

SCOP Domain Coordinates for d1onea1:

Click to download the PDB-style file with coordinates for d1onea1.
(The format of our PDB-style files is described here.)

Timeline for d1onea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1onea2