Lineage for d1qr7a_ (1qr7 A:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 18353Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies)
  4. 19200Superfamily c.1.10: Aldolase [51569] (4 families) (S)
  5. 19350Family c.1.10.4: Class I DAHP synthetase [51599] (2 proteins)
  6. 19351Protein 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase (DAHP synthase, AroG) [51600] (1 species)
  7. 19352Species Escherichia coli [TaxId:562] [51601] (2 PDB entries)
  8. 19357Domain d1qr7a_: 1qr7 A: [29191]

Details for d1qr7a_

PDB Entry: 1qr7 (more details), 2.6 Å

PDB Description: crystal structure of phenylalanine-regulated 3-deoxy-d-arabino-heptulosonate-7-phosphate synthase from escherichia coli complexed with pb2+ and pep

SCOP Domain Sequences for d1qr7a_:

Sequence, based on SEQRES records: (download)

>d1qr7a_ c.1.10.4 (A:) 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase (DAHP synthase, AroG) {Escherichia coli}
lrikeikellppvallekfpatenaantvaharkaihkilkgnddrllvvigpcsihdpv
aakeyatrllalreelkdeleivmrvyfekprttvgwkglindphmdnsfqindglriar
kllldindsglpaagefldmitpqyladlmswgaigarttesqvhrelasglscpvgfkn
gtdgtikvaidainaagaphcflsvtkwghsaivntsgngdchiilrggkepnysakhva
evkeglnkaglpaqvmidfshansskqfkkqmdvcadvcqqiaggekaiigvmveshlve
gnqslesgeplaygksitdacigwedtdallrqlanavkarrg

Sequence, based on observed residues (ATOM records): (download)

>d1qr7a_ c.1.10.4 (A:) 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase (DAHP synthase, AroG) {Escherichia coli}
lrikeikellppvallekfpatenaantvaharkaihkilkgnddrllvvigpcsihdpv
aakeyatrllalreelkdeleivmrvyfekprttvgwkglindphmdnsfqindglriar
kllldindsglpaagefldmitpqyladlmswgaigarttesqvhrelasglscpvgfkn
gtdgtikvaidainaagaphcflsvtkwghsaivntsgngdchiilrggkepnysakhva
evkeglnkaglpaqvmidfshansskqfkkqmdvcadvcqqiaggekaiigvmveshlve
gnqsllaygksitdacigwedtdallrqlanavkarrg

SCOP Domain Coordinates for d1qr7a_:

Click to download the PDB-style file with coordinates for d1qr7a_.
(The format of our PDB-style files is described here.)

Timeline for d1qr7a_: