SCOPe 2.06: Domain d2xoki_: 2xok I:

Lineage for d2xoki_ (2xok I:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
   not a true fold

4. Superfamily a.137.8: Epsilon subunit of mitochondrial F1F0-ATP synthase [48690] (1 family)
   automatically mapped to Pfam PF04627

5. Family a.137.8.1: Epsilon subunit of mitochondrial F1F0-ATP synthase [48691] (2 proteins)

6. Protein automated matches [190373] (2 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [311254] (1 PDB entry)

8. Domain d2xoki_: 2xok I: [290236]
   Other proteins in same PDB: d2xokd1, d2xokd2, d2xokd3, d2xoke1, d2xoke2, d2xoke3, d2xokf1, d2xokf2, d2xokf3, d2xokg_, d2xokh1, d2xokh2
   automated match to d2hldi_
   complexed with anp, mg

Details for d2xoki_

PDB Entry: 2xok, 3.01 Å

PDB Description: refined structure of yeast f1c10 atpase complex to 3 a resolution

PDB Compounds: (I:) ATP synthase catalytic sector f1 epsilon subunit

SCOPe Domain Sequences for d2xoki_:

Sequence, based on SEQRES records:

>d2xoki_ a.137.8.1 (I:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
msyaaylnvaaqairsslktelqtasvtnrsqtdafytqykngtaaseptpmtk

Sequence, based on observed residues (ATOM records):

>d2xoki_ a.137.8.1 (I:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
msyaaylnvaaqairsstelqtasvtnrsqtdafytqyknaseptpmtk

Timeline for d2xoki_:

• d2xoki_ is new in SCOPe 2.06-stable
  
• d2xoki_ appears in SCOPe 2.07
  
• d2xoki_ appears in the current release, SCOPe 2.08