Lineage for d1qbba3 (1qbb A:338-780)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2438500Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2440644Family c.1.8.6: beta-N-acetylhexosaminidase catalytic domain [51550] (6 proteins)
    Glycosyl hydrolase family 20, GH20
    automatically mapped to Pfam PF00728
  6. 2440645Protein Bacterial chitobiase (beta-N-acetylhexosaminidase) [51551] (1 species)
  7. 2440646Species Serratia marcescens [TaxId:615] [51552] (4 PDB entries)
  8. 2440648Domain d1qbba3: 1qbb A:338-780 [29010]
    Other proteins in same PDB: d1qbba1, d1qbba2, d1qbba4
    complexed with cbs, so4

Details for d1qbba3

PDB Entry: 1qbb (more details), 2 Å

PDB Description: bacterial chitobiase complexed with chitobiose (dinag)
PDB Compounds: (A:) chitobiase

SCOPe Domain Sequences for d1qbba3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qbba3 c.1.8.6 (A:338-780) Bacterial chitobiase (beta-N-acetylhexosaminidase) {Serratia marcescens [TaxId: 615]}
fpyrgifldvarnfhkkdavlrlldqmaayklnkfhfhlsddegwrieipglpeltevgg
qrchdlsettcllpqygqgpdvyggffsrqdyidiikyaqarqievipeidmpaharaav
vsmearykklhaagkeqeanefrlvdptdtsnttsvqffnrqsylnpcldssqrfvdkvi
geiaqmhkeagqpiktwhfggdeaknirlgagytdkakpepgkgiidqgnedkpwaksqv
cqtmikegkvadmehlpsyfgqevsklvkahgidrmqawqdglkdaesskafatsrvgvn
fwdtlywggfdsvndwankgyevvvsnpdyvymdfpyevnpdergyywgtrfsderkvfs
fapdnmpqnaetsvdrdgnhfnaksdkpwpgayglsaqlwsetqrtdpqmeymifprals
vaerswhragweqdyragreykg

SCOPe Domain Coordinates for d1qbba3:

Click to download the PDB-style file with coordinates for d1qbba3.
(The format of our PDB-style files is described here.)

Timeline for d1qbba3: