Lineage for d1ctn_2 (1ctn 133-443,517-561)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 115904Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies)
  4. 116348Superfamily c.1.8: (Trans)glycosidases [51445] (9 families) (S)
  5. 116871Family c.1.8.5: Type II chitinase [51534] (7 proteins)
  6. 116875Protein Chitinase A, catalytic domain [51544] (1 species)
  7. 116876Species Serratia marcescens [TaxId:615] [51545] (5 PDB entries)
  8. 116881Domain d1ctn_2: 1ctn 133-443,517-561 [29005]
    Other proteins in same PDB: d1ctn_1, d1ctn_3

Details for d1ctn_2

PDB Entry: 1ctn (more details), 2.3 Å

PDB Description: crystal structure of a bacterial chitinase at 2.3 angstroms resolution

SCOP Domain Sequences for d1ctn_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ctn_2 c.1.8.5 (133-443,517-561) Chitinase A, catalytic domain {Serratia marcescens}
tdgshlaplkeplleknkpykqnsgkvvgsyfvewgvygrnftvdkipaqnlthllygfi
picggngindslkeiegsfqalqrscqgredfkisihdpfaalqkaqkgvtawddpykgn
fgqlmalkqahpdlkilpsiggwtlsdpfffmgdkvkrdrfvgsvkeflqtwkffdgvdi
dwefpggkganpnlgspqdgetyvllmkelramldqlstetgrkyeltsaisagkdkidk
vaynvaqnsmdhiflmsydfygafdlknlghqtalnapawkpdtayttvngvnallaqgv
kpgkivvgtamXdarsvqakgkyvldkqlgglfsweidadngdilnsmnaslgnsag

SCOP Domain Coordinates for d1ctn_2:

Click to download the PDB-style file with coordinates for d1ctn_2.
(The format of our PDB-style files is described here.)

Timeline for d1ctn_2: