Lineage for d1ehna2 (1ehn A:133-443,A:517-563)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 18353Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies)
  4. 18710Superfamily c.1.8: (Trans)glycosidases [51445] (7 families) (S)
  5. 19083Family c.1.8.5: Type II chitinase [51534] (6 proteins)
  6. 19087Protein Chitinase A, catalytic domain [51544] (1 species)
  7. 19088Species Serratia marcescens [TaxId:615] [51545] (4 PDB entries)
  8. 19091Domain d1ehna2: 1ehn A:133-443,A:517-563 [29004]
    Other proteins in same PDB: d1ehna1, d1ehna3

Details for d1ehna2

PDB Entry: 1ehn (more details), 1.9 Å

PDB Description: crystal structure of chitinase a mutant e315q complexed with octa-n- acetylchitooctaose (nag)8.

SCOP Domain Sequences for d1ehna2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ehna2 c.1.8.5 (A:133-443,A:517-563) Chitinase A, catalytic domain {Serratia marcescens}
tdgshlaplkeplleknkpykqnsgkvvgsyfvewgvygrnftvdkipaqnlthllygfi
picggngindslkeiegsfqalqrscqgredfkvsihdpfaalqkaqkgvtawddpykgn
fgqlmalkqahpdlkilpsiggwtlsdpfffmgdkvkrdrfvgsvkeflqtwkffdgvdi
dwqfpggkganpnlgspqdgetyvllmkelramldqlsvetgrkyeltsaisagkdkidk
vaynvaqnsmdhiflmsydfygafdlknlghqtalnapawkpdtayttvngvnallaqgv
kpgkivvgtamXdarsvqakgkyvldkqlgglfsweidadngdilnsmnaslgnsagvq

SCOP Domain Coordinates for d1ehna2:

Click to download the PDB-style file with coordinates for d1ehna2.
(The format of our PDB-style files is described here.)

Timeline for d1ehna2: