Lineage for d1c91a_ (1c91 A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2093018Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2094740Family c.1.8.5: Type II chitinase [51534] (15 proteins)
    glycosylase family 18
  6. 2094881Protein Endo-beta-N-acetylglucosaminidase [51540] (3 species)
  7. 2094887Species Streptomyces plicatus, endoglycosidase H [TaxId:1922] [51543] (8 PDB entries)
  8. 2094896Domain d1c91a_: 1c91 A: [29000]

Details for d1c91a_

PDB Entry: 1c91 (more details), 2.1 Å

PDB Description: endo-beta-n-acetylglucosaminidase h, e132d
PDB Compounds: (A:) endo-beta-n-acetylglucosaminidase h

SCOPe Domain Sequences for d1c91a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c91a_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Streptomyces plicatus, endoglycosidase H [TaxId: 1922]}
kqgptsvayvevnnnsmlnvgkytladgggnafdvavifaaninydtgtktaylhfnenv
qrvldnavtqirplqqqgikvllsvlgnhqgagfanfpsqqaasafakqlsdavakygld
gvdfdddyaeygnngtaqpndssfvhlvtalranmpdkiislynigpaasrlsyggvdvs
dkfdyawnpyygtwqvpgialpkaqlspaaveigrtsrstvadlarrtvdegygvyltyn
ldggdrtadvsaftrelygseavrt

SCOPe Domain Coordinates for d1c91a_:

Click to download the PDB-style file with coordinates for d1c91a_.
(The format of our PDB-style files is described here.)

Timeline for d1c91a_: