Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.5: Type II chitinase [51534] (15 proteins) glycosylase family 18 |
Protein Endo-beta-N-acetylglucosaminidase [51540] (3 species) |
Species Streptomyces plicatus, endoglycosidase H [TaxId:1922] [51543] (8 PDB entries) |
Domain d1edta_: 1edt A: [28993] |
PDB Entry: 1edt (more details), 1.9 Å
SCOPe Domain Sequences for d1edta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1edta_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Streptomyces plicatus, endoglycosidase H [TaxId: 1922]} kqgptsvayvevnnnsmlnvgkytladgggnafdvavifaaninydtgtktaylhfnenv qrvldnavtqirplqqqgikvllsvlgnhqgagfanfpsqqaasafakqlsdavakygld gvdfddeyaeygnngtaqpndssfvhlvtalranmpdkiislynigpaasrlsyggvdvs dkfdyawnpyygtwqvpgialpkaqlspaaveigrtsrstvadlarrtvdegygvyltyn ldggdrtadvsaftrelygseavrt
Timeline for d1edta_: