SCOP 1.75: Domain d1eoma_: 1eom A:

Lineage for d1eoma_ (1eom A:)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (14 families)

5. Family c.1.8.5: Type II chitinase [51534] (14 proteins)
   glycosylase family 18

6. Protein Endo-beta-N-acetylglucosaminidase [51540] (3 species)

7. Species Flavobacterium meningosepticum, endoglycosidase F3 [TaxId:238] [51542] (2 PDB entries)

8. Domain d1eoma_: 1eom A: [28992]
   complexed with gal, man, nag, so4

Details for d1eoma_

PDB Entry: 1eom, 2.1 Å

PDB Description: crystal structure of the complex of endo-beta-n-acetylglucosaminidase f3 with a biantennary complex octasaccharide

PDB Compounds: (A:) endo-beta-n-acetylglucosaminidase f3

SCOP Domain Sequences for d1eoma_:

Sequence; same for both SEQRES and ATOM records:

>d1eoma_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Flavobacterium meningosepticum, endoglycosidase F3 [TaxId: 238]}
ngvciayyitdgrnptfklkdipdkvdmvilfglkywslqdttklpggtgmmgsfksykd
ldtqirslqsrgikvlqnidddvswqsskpggfasaaaygdaiksividkwkldgisldi
ehsgakpnpiptfpgyaatgyngwysgsmaatpaflnviseltkyfgttapnnkqlqias
gidvyawnkimenfrnnfnyiqlqsyganvsrtqlmmnyatgtnkipaskmvfgayaegg
tnqandvevakwtptqgakggmmiytynsnvsyanavrdavkn

Timeline for d1eoma_:

• d1eoma_ first appeared (with stable ids) in SCOP 1.55
  
• d1eoma_ appears in SCOP 1.73
  
• d1eoma_ appears in SCOPe 2.01
  
• d1eoma_ appears in the current release, SCOPe 2.08