Lineage for d2ebn__ (2ebn -)
- Root: SCOP 1.61
Class c: Alpha and beta proteins (a/b) [51349] (117 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (25 superfamilies) Superfamily c.1.8: (Trans)glycosidases [51445] (9 families) 
Family c.1.8.5: Type II chitinase [51534] (9 proteins) 
Protein Endo-beta-N-acetylglucosaminidase [51540] (3 species) 
Species Flavobacterium meningosepticum, endoglycosidase F1 [TaxId:238] [51541] (1 PDB entry) 
Domain d2ebn__: 2ebn - [28990]
Details for d2ebn__
PDB Entry: 2ebn (more details), 2 Å
PDB Description: crystal structure of endo-beta-n-acetylglucosaminidase f1, an alpha(slash)beta-barrel enzyme adapted for a complex substrate
SCOP Domain Sequences for d2ebn__:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ebn__ c.1.8.5 (-) Endo-beta-N-acetylglucosaminidase {Flavobacterium meningosepticum, endoglycosidase F1}
ttkaniklfsftevndtnplnnlnftlknsgkplvdmvvlfsaninydaandkvfvsnnp
nvqhlltnrakylkplqdkgikvilsilgnhdrsgianlstarakafaqelkntcdlynl
dgvffddeysayqtpppsgfvtpsnnaaarlayetkqampnklvtvyvysrtssfptavd
gvnagsyvdyaihdyggsydlatnypglaksgmvmssqefnqgryataqalrnivtkgyg
ghmifamdpnrsnftsgqlpalkliakelygdelvysntpyskdw
SCOP Domain Coordinates for d2ebn__:
Click to download the PDB-style file with coordinates for d2ebn__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2ebn__:
- d2ebn__ first appeared (with stable ids) in SCOP 1.55
- d2ebn__ appears in SCOP 1.59
- d2ebn__ appears in SCOP 1.63
- d2ebn__ appears in the current release, SCOPe 2.08, called d2ebna_
View in 3D